Tag definition

Tag or “RFID tag” means the unique identification number or Radio Frequency Identification (RFID) issued to a licensee by the agency for tracking, identifying and verifying marihuana plants, marihuana products, and packages of marihuana product in the statewide monitoring system.
Tag means the RMS device installed in the Vehicle to enable the payment of Tolls by electronic means.
Tag means a record of harvesting information attached to a container of shellstock by the harvester or proc- essor. § 123.5 § 123.5 Current good manufacturing practice.(a) Part 110 of this chapter applies in determining whether the facilities, methods, practices, and controls used to process fish and fishery products are safe, and whether these products have been processed under sanitary condi- tions.(b) The purpose of this part is to set forth requirements specific to the proc- essing of fish and fishery products.§ 123.6 Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan.(a) Hazard analysis. Every processor shall conduct, or have conducted for it, a hazard analysis to determine whether there are food safety hazards that are reasonably likely to occur for each kind of fish and fishery product proc- essed by that processor and to identify the preventive measures that the proc- essor can apply to control those haz- ards. Such food safety hazards can be introduced both within and outside the processing plant environment, includ- ing food safety hazards that can occur before, during, and after harvest. A food safety hazard that is reasonably likely to occur is one for which a pru- dent processor would establish controls because experience, illness data, sci- entific reports, or other information provide a basis to conclude that there is a reasonable possibility that it will occur in the particular type of fish or fishery product being processed in the absence of those controls.(b) The HACCP plan. Every processorshall have and implement a written HACCP plan whenever a hazard anal- ysis reveals one or more food safety hazards that are reasonably likely to occur, as described in paragraph (a) of this section. A HACCP plan shall be specific to:

Examples of Tag in a sentence

  • Zur Klarstellung: wenn das Ereignis, das zum Referenzzinssatz-Ersetzungstermin führt, am selben Tag, aber zeitlich vor der Referenzzeit hinsichtlich jeder Festsetzung eintritt, dann gilt der Referenzzinssatz- Ersetzungstermin für diese Festsetzung als vor der Referenzzeit eingetreten.

  • Must use National Stock Number (NSN) when known, except when appropriate brand name subsistence items are identified by the Subsistence Identification Number or when maintenance/industrial activity materiel is identified by Local Stock Number or Material Control Tracking (MCT) Tag Number.

  • Indexstand in Bezug auf einen Index der an einem Planmässigen Handelstag für diesen Tag jeweils von dem Lizenzgeber/ Index-Sponsor berechnete und veröffentlichte Stand dieses Index, wie von der Berechnungsstelle festgestellt.

  • Fällt ein solcher Fälligkeitstag auf einen Tag, der kein Geschäftstag ist, so ist die Emittentin verpflichtet, die betreffenden Beträge mit Wertstellung an dem unmittelbar auf den Fälligkeitstag folgenden Geschäftstag zu überweisen.

  • The syntax terms are usually entered automatically by using the appropriate item in the submenu of the Enter Tag item in the Search or right-click menu as shown.


More Definitions of Tag

Tag means a representation of an internal or external data value or calculation result.
Tag means to place distinct markers on wires and cables, coded by color or other means approved by the District and/or applicable federal, state or local regulations, that will readily identify, from the ground, its owner and cable type.
Tag means a card, label, or other paper-based or electronic means of identification used to document harvest of protected wildlife.
Tag means a written document that is required under this Chapter to be posted conspicuously at a pretreatment or new- construction treatment site.
Tag. Along Right" 16.4 "Transaction Proposal" 16.3 "Transfer" 16.1 "Transferee Terms" 16.4 "Transferring Shareholder" 16.4
Tag means The Americas Group.
Tag means a protein or any other molecule comprising the amino acid sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK described in and protected by the Patent Rights (A), the use of which but for this Limited Use License would infringe one or more Valid Claims of Patent Rights (A).