Tag definition

Tag or “RFID tag” means the unique identification number or Radio Frequency Identification (RFID) issued to a licensee by the agency for tracking, identifying and verifying marihuana plants, marihuana products, and packages of marihuana product in the statewide monitoring system.
View Source
Tag means the RMS device installed in the Vehicle to enable the payment of Tolls by electronic means.
View Source
Tag means to place distinct markers on wires and cables, coded by color or other means approved by the District and/or applicable federal, state or local regulations, that will readily identify, from the ground, its owner and cable type.
View Source

Examples of Tag in a sentence

  • The Tire Tag is responsible for replacing devices from being unpaid or damaged due to being deployed on a vehicle at no additional charge within 28 business days of being notified by the Client.

  • If a Tire Tag device is damaged by a violator, it is the financial liability of the violator to cover this cost.

  • The Tire Tag - The Client agrees to re-imburse the Company for The Tire Tag set up fee within 30 days of the Effective Date of this Agreement, in which case the product will be shipped.

  • If a prospective Tag Purchaser(s) refuses to purchase Units from a Tagging Member, the Majority Member(s) shall not sell any Units to such prospective Tag Purchaser(s) unless and until, simultaneously with such sale, the Majority Member(s) shall purchase Units from the Tagging Members for the same consideration and on the same terms and conditions as the Tag Along Sale described in the Transfer Notice.

  • Upon 1Net Revenue: Total charged to violator less Tire Tag Fees, 1099 Fees, Processing Fees and Taxes the request of the Company, the Client shall furnish to the Company an affidavit providing assurances as to the return or destruction of the Company’s proprietary information.


More Definitions of Tag

Tag means a representation of an internal or external data value or calculation result.
View Source
Tag means a protein or any other molecule comprising the amino acid sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK described in and protected by the Patent Rights (A), the use of which but for this Limited Use License would infringe one or more Valid Claims of Patent Rights (A).
View Source
Tag means a type of license tag or plate for a motor vehicle or trailer that the Agency is authorized to issue or approve for issuance under the Mississippi Motor Vehicle Privilege Tax Law, Miss. Code Ann. Sections 27-19-1, et seq., or under the Motor Vehicle Dealer Tag Permit Law, Miss. Code Ann. Sections 27-19-301, et seq. The term “tag” includes personalized license tags. “Tag” does not include other types of license tags or plates issued by county tax collectors.
View Source
Tag means a written document that is required under this Chapter to be posted conspicuously at a pretreatment or new- construction treatment site.
View Source
Tag means The Americas Group.
View Source
Tag means a card, label, or other paper-based or electronic means of identification used to document harvest of protected wildlife.
View Source
Tag means a card, label, or other paper-based or electronic means of
View Source